HomePolitics

A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim

  1. Home
  2. Politics
  3. A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim

A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim

Millions may get COVID-era tax refunds if they file by Friday, but the IRS is appealing the ruling.

cbsnewstime-magazine2 sources
A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim

Photo: Solomon203 / Wikimedia Commons (Public domain)

This story is currently reported by Time. Additional perspectives are added automatically as more outlets cover it.

Full Coverage

2 articles · chronological
TimeTime
A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim
CBS NewsCBS News
Millions of Americans have until July 10 to claim refunds from the IRS

About this analysis

NewsFactsHQ synthesizes 2 independent sources into one neutral, factual account, then shows you how each outlet frames it so you can decide for yourself.

  • 2Sourcesindependent
  • 2Articlesfound
  • 0Factsin synthesis
  • 0Anglesfrom outlets
How it worksEditorial accountability

Jouw mening

Do you find the coverage of this topic balanced?

Give direct feedback to our algorithms so we can make NewsFactsHQ even more objective.

Daily Download

Get a morning briefing of the day's top US news. Facts only, no spam. Unsubscribe anytime.

More onPoliticsBusiness & Economy

Full Coverage

2 articles · chronological

TimeTime
A Key Deadline for COVID-Era Tax Refunds Is Approaching. How to Know If You Qualify, and How to Make a Claim
CBS NewsCBS News
Millions of Americans have until July 10 to claim refunds from the IRS

More in the News

Politics

Maine Senate Candidate Graham Platner Withdraws Amid Allegations

Maine's Democratic Senate candidate Graham Platner has withdrawn from the race following sexual assault allegations and past controversies. His exit has drawn criticism and commentary from various political figures and media outlets regarding his tactics and the vetting process.

nationalreviewthehillrealclearpoliticsreason-magazinethebulwark+16 sources·5 angles·5h ago
Crime & Justice

Former Olympian Pleads Not Guilty to Damaging Reflecting Pool

Former Olympian David Hearn has pleaded not guilty to charges of vandalizing the Lincoln Memorial Reflecting Pool. Hearn's lawyer stated that his client is being made a scapegoat and that it is not a crime to touch water. The specific details of the alleged damage and the timeline of events were not provided in the articles.

tmzpittsburgh-post-gazetteupicbsnewsfoxnews+1217 sources·5 angles·4h ago
Politics

Patrick Dempsey Decides Against Running for U.S. Senate in Maine

Actor Patrick Dempsey has revealed that he gave serious consideration to running for the U.S. Senate in Maine. However, he ultimately decided against pursuing a political career, stating that he is concerned about the country's direction and will continue to use his current platform. The actor reportedly considered the run following the Graham Platner scandal.

varietyentertainment-weeklydeadlinepbsseattletimes+813 sources·5 angles·6h ago
World

Trump grants Ukraine license to produce Patriot missiles

Former President Donald Trump has announced that the United States will grant Ukraine a license to manufacture Patriot missile interceptors. This decision allows Ukraine to produce the defensive weapon systems domestically. The move has been met with cautious optimism by some Ukrainian officials and has been described as a significant shift by experts.

cbsnewsftnytscrippsnewstime-magazine+712 sources·5 angles·7h ago
Politics

Appeals court denies Trump's request to keep his name on Kennedy Center

A federal appeals court has denied Donald Trump's request to restore his name to the Kennedy Center. The court cited a lack of evidence supporting the claim that the center would suffer financial decline without his name. Trump's name must therefore remain off the building pending further appeal.

upiwashington-examinerthehillpbsvariety+38 sources·5 angles·9h ago
Sports

Yankees Lose to Rays Amidst Offensive Struggles and Roster Decisions

The New York Yankees lost to the Tampa Bay Rays with a score of 3-0, continuing a slump marked by poor offensive performance. The team also made roster decisions, including starting Paul Blackburn and having Anthony Volpe out of the lineup for Thursday's game. Concerns have been raised about both the Yankees' offense and pitching staff.

tampabayyahoo-sportsnj-com3 sources·5 angles·4h ago

NewsFactsHQ

Every side of the story

We show how different outlets report the same story, without labels or scores, and let you decide what to think.

Read more about NewsFactsHQ

Topics

  • Politics
  • Business & Economy
  • World
  • Immigration
  • Crime & Justice
  • Health
  • Environment
  • Technology
  • Education
  • Defense & Military
  • Entertainment
  • Sports

NewsFactsHQ

  • About Us
  • How It Works
  • Archive
  • Contact

Contact

NewsFactsHQ@proton.me
@newsfactshq

© 2026 NewsFactsHQ

Privacy PolicyEditorial AccountabilityCookie PolicyTerms of Service